PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold18391-snap-gene-0.8-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family MYB_related
Protein Properties Length: 101aa    MW: 11685.5 Da    PI: 9.589
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold18391-snap-gene-0.8-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.2e-181461148
                                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                              rg WT+eEd +++ +v  +G g+W++++++ g++R++k+c++rw +yl
  maker-scaffold18391-snap-gene-0.8-mRNA-1 14 RGLWTAEEDAKILAYVSNHGIGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
                                              789*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.5E-25564IPR009057Homeodomain-like
PROSITE profilePS5129424.361965IPR017930Myb domain
SMARTSM007173.4E-131363IPR001005SANT/Myb domain
PfamPF002494.7E-161461IPR001005SANT/Myb domain
SuperFamilySSF466891.54E-231690IPR009057Homeodomain-like
CDDcd001678.43E-111761No hitNo description
PROSITE profilePS500904.3446289IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.9E-86589IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 101 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTAE EDAKILAYVS NHGIGNWTLV PKKAGLNRCG KSCRLRWTNY  60
LRSDLKHDGF TPQEEELIIN LHKAIGSRWV FKYMTHIFTC Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-151490782B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083639.11e-61PREDICTED: transcription repressor MYB6
SwissprotQ9LSI71e-55MYB35_ARATH; Transcription factor MYB35
TrEMBLA0A067LL301e-61A0A067LL30_JATCU; MYB family protein
STRINGGLYMA13G04920.12e-58(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.18e-57MYB family protein